- G2A/GPR132 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89807
- Human
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: NGYNGNATPV TTTAPWASLG LSAKTCNNVS FEESRI
- Immunohistochemistry, Immunohistochemistry-Paraffin
- G2A
- Unconjugated
- G2A/GPR132
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- G protein-coupled receptor 132
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- GPCR
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
NGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRI
Specifications/Features
Available conjugates: Unconjugated